General Information

  • ID:  hor006308
  • Uniprot ID:  Q8AYR6
  • Protein name:  C-type natriuretic peptide 1
  • Gene name:  cnp-1
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Brain and spinal cord.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GWNRGCFGLKLDRIGSMSGLGC
  • Length:  22
  • Propeptide:  MLCPVLLCATLLLLTPFEVTEARALHPSADAVQFVEQFLDRYNDLLTLDDLENLLNTQPEEQSTLSSGVKTAEYPKWADLQTQPETPWFRLLKGALTNQKRAEPDRSRRGWNRGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MLCPVLLCATLLLLTPFEVTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressant activity. Has cGMP-stimulating activity. May help to regulate body fluid homeostasis in a variety of aquatic environments.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-22
  • Structure ID:  AF-Q8AYR6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006308_AF2.pdbhor006308_ESM.pdb

Physical Information

Mass: 270249 Formula: C99H159N31O28S3
Absent amino acids: AEHPQTVY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: 3.64 Boman Index: -2201
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.91
Instability Index: 2573.18 Extinction Coefficient cystines: 5625
Absorbance 280nm: 267.86

Literature

  • PubMed ID:  12893874
  • Title:  Four functionally distinct C-type natriuretic peptides found in fish reveal evolutionary history of the natriuretic peptide system.